PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G02420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 314aa    MW: 34416.5 Da    PI: 5.5553
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G02420.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.22.2e-193380148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd llvd+++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  ORUFI05G02420.1 33 RGPWTVEEDMLLVDYIANHGEGRWNSLARCAGLRRTGKSCRLRWLNYL 80
                     89********************************************97 PP

2Myb_DNA-binding513.2e-1686129146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  ORUFI05G02420.1  86 RGNITADEQLLILDLHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 129
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1992880IPR017930Myb domain
SuperFamilySSF466894.12E-3131127IPR009057Homeodomain-like
SMARTSM007171.5E-153282IPR001005SANT/Myb domain
PfamPF002496.4E-173380IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-233487IPR009057Homeodomain-like
CDDcd001678.75E-123580No hitNo description
PROSITE profilePS5129422.52781135IPR017930Myb domain
SMARTSM007174.2E-1485133IPR001005SANT/Myb domain
PfamPF002491.4E-1486129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2288134IPR009057Homeodomain-like
CDDcd001672.06E-1090129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MDLEMEMMRM AMSPAMSSAT AAAASEDEGD LRRGPWTVEE DMLLVDYIAN HGEGRWNSLA  60
RCAGLRRTGK SCRLRWLNYL RPDVRRGNIT ADEQLLILDL HSRWGNRWSK IAQYLPGRTD  120
NEIKNYWRTR VQKHAKQLRC DVNSKEFRDV VRHVWMPRLV ERIQADAAAA GEVAAPAPVS  180
AAATRSMSSP AGAIYLHHQQ IPLAAGAMVV APAVSSEAYH HHGCGGGGDT SCSEPSQAAV  240
TMSPDDASST LRSSSAAAEN DTIHGDVLSG SWSELLATTT TTIAATAGLP DFDELGDFED  300
NLWSLEDIWL HQQC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-253012724120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1182880.0AC118288.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0077L08, complete sequence.
GenBankAK2436590.0AK243659.1 Oryza sativa Japonica Group cDNA, clone: J100089B08, full insert sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638460.10.0PREDICTED: transcription factor MYB108
TrEMBLA0A0E0PH530.0A0A0E0PH53_ORYRU; Uncharacterized protein
STRINGLOC_Os05g04210.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.14e-80myb domain protein 112